Real-time cybersecurity intelligence from global threat feeds
ivvvaaannaaalaaawiiiiifamilly.blogspot.com
This domain has been identified by 1 independent threat intelligence feed as being associated with malicious activity.
Multiple source confirmation significantly increases confidence in threat classification.
OziShield recommends avoiding all interaction with this domain.
If you received a link to this domain via email, SMS, or social media, do not click it. Report phishing to ACSC ReportCyber .
Database Coverage
110,925+ active threats tracked
Last Updated
August 15, 2026
Independent threat intelligence provider.